PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g24400.1.p
Common NameBRADI_2g24400, LOC100842957
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 234aa    MW: 25929.3 Da    PI: 8.5628
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g24400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
  Bradi2g24400.1.p 14 KGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding51.32.6e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++  Edel+++++ +lG++ W++Ia  ++ gRt++++k++w+++
  Bradi2g24400.1.p  67 RGNFSDHEDELIIRLHGLLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.698961IPR017930Myb domain
SuperFamilySSF466899.73E-2913108IPR009057Homeodomain-like
SMARTSM007176.7E-141363IPR001005SANT/Myb domain
PfamPF002499.7E-161461IPR001005SANT/Myb domain
CDDcd001671.26E-111661No hitNo description
PROSITE profilePS5129426.15762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-2765116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002496.5E-1467111IPR001005SANT/Myb domain
CDDcd001672.84E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRSPCCEKE HTNKGAWTKE EDQRLIAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF SDHEDELIIR LHGLLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLSRG  120
MNPRTHRPLT TPTTAPLQPA AMLALARPPQ AESSSDGGSS GTGEPPRCPD LNLDLSVGPP  180
AADTESTTTS QVCLCYHLGF RGGEACSCRL HQADDDTSSG FRYFRPLEQG QYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3687281e-156AK368728.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2078M17.
GenBankJF9519031e-156JF951903.1 Triticum aestivum clone TaMYB19 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568394.11e-174PREDICTED: myb-related protein Zm38-like
SwissprotP813933e-92MYB08_ANTMA; Myb-related protein 308
TrEMBLI1HJ481e-174I1HJ48_BRADI; Uncharacterized protein
STRINGBRADI2G24400.11e-173(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-81myb domain protein 6